PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy010103
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 515aa    MW: 55649 Da    PI: 8.7274
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59542597PU_refUnigeneView CDS
gnl|UG|Ahy#S58474889PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY77.51.5e-24202258259
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                +Dgy+WrKYGqK+vk+ + +rsYYrCt+++C++kk +e++++ ++v++++Y+++H h+
  Ahy010103 202 SDGYSWRKYGQKQVKSPTGSRSYYRCTHSECSAKK-IECNDDVGRVIDVVYKSQHSHD 258
                8********************************98.*********************7 PP

2WRKY97.49.5e-31377433359
                -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ ++ ++v+itY+g H+h+
  Ahy010103 377 DGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKHIETAVDNSNAVIITYKGVHDHD 433
                9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.5E-20198260IPR003657WRKY domain
SuperFamilySSF1182903.53E-19199260IPR003657WRKY domain
SMARTSM007742.2E-23201259IPR003657WRKY domain
PROSITE profilePS5081118.269202260IPR003657WRKY domain
PfamPF031062.1E-18203258IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-31360435IPR003657WRKY domain
PROSITE profilePS5081131.904370435IPR003657WRKY domain
SuperFamilySSF1182903.79E-27371435IPR003657WRKY domain
SMARTSM007742.7E-35375434IPR003657WRKY domain
PfamPF031061.6E-23377432IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MAEQPSSAEA VTEGAPELLP KEKDSEGGEG GNEQGQQGKA SEGEERASES PCETESQRAV  60
MKSSDKPPKG SNSGTLAAES LVVNNRSDEL QGSPATPNMD VKAESKETDG PREKETIASE  120
AVQPPPTQIE NQPQVSACST PLSELSPTSV TQSLSSVPSQ IAPKQKMPPL KINNVHVPQL  180
DKKIPSGGKH VSCGSVARVS VSDGYSWRKY GQKQVKSPTG SRSYYRCTHS ECSAKKIECN  240
DDVGRVIDVV YKSQHSHDPP HKPNSTRESK LVSSSEPPNV ENKVSQQLSI RGLKNSDPSP  300
SKEPLQDAPR TADKKRPNSS NLSDNGKVIL KEEHVNEPEP KKRMKKDDLA DLDSPVKSGK  360
KSRFVVHAEG DVGISGDGYR WRKYGQKMVK GNPHPRNYYR CTSAGCPVRK HIETAVDNSN  420
AVIITYKGVH DHDMPVPKKR RGPPSAPLVA AAAPASMNNS QSKKKPDSPK KQNKSTQWSV  480
DTEGELSGEA MDLGGEKAME SARTLLSIGF EIKPC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A6e-27362435174WRKY transcription factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016200233.10.0PREDICTED: probable WRKY transcription factor 32
SwissprotP595831e-129WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLV7CC730.0V7CC73_PHAVU; Uncharacterized protein
STRINGGLYMA02G36510.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-119WRKY DNA-binding protein 32